Anti-JUND
Artikelnummer:
ATA-HPA063029
- Bilder (7)
| Artikelname: | Anti-JUND |
| Artikelnummer: | ATA-HPA063029 |
| Hersteller Artikelnummer: | HPA063029 |
| Alternativnummer: | ATA-HPA063029-100,ATA-HPA063029-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AP-1 |
| jun D proto-oncogene |
| Anti-JUND |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3727 |
| UniProt: | P17535 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | JUND |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
HPA063029-100ul |
|
|
|
|
|
HPA063029-100ul |
|
|
HPA063029-100ul |
Produktgarantie und fachkundiger Support
