Anti-DNAJB1
Artikelnummer:
ATA-HPA063247
- Bilder (9)
| Artikelname: | Anti-DNAJB1 |
| Artikelnummer: | ATA-HPA063247 |
| Hersteller Artikelnummer: | HPA063247 |
| Alternativnummer: | ATA-HPA063247-100,ATA-HPA063247-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Hsp40, HSPF1, RSPH16B, Sis1 |
| DnaJ (Hsp40) homolog, subfamily B, member 1 |
| Anti-DNAJB1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3337 |
| UniProt: | P25685 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAJB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleus. |
|
|
Immunohistochemistry analysis in human adrenal gland and duodenum tissues using Anti-DNAJB1 antibody. Corresponding DNAJB1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
|
|
|
HPA063247-100ul |
|
|
HPA063247-100ul |
|
|
HPA063247-100ul |
Produktgarantie und fachkundiger Support
