Anti-TMEM186

Artikelnummer: ATA-HPA063559
Artikelname: Anti-TMEM186
Artikelnummer: ATA-HPA063559
Hersteller Artikelnummer: HPA063559
Alternativnummer: ATA-HPA063559-100,ATA-HPA063559-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C16orf51, DKFZP564K2062
transmembrane protein 186
Anti-TMEM186
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 25880
UniProt: Q96B77
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TMEM186
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
HPA063559-100ul