Anti-LIMCH1
Artikelnummer:
ATA-HPA063840
- Bilder (8)
| Artikelname: | Anti-LIMCH1 |
| Artikelnummer: | ATA-HPA063840 |
| Hersteller Artikelnummer: | HPA063840 |
| Alternativnummer: | ATA-HPA063840-100,ATA-HPA063840-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZP686A01247, LIMCH1A, LMO7B |
| LIM and calponin homology domains 1 |
| Anti-LIMCH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 22998 |
| UniProt: | Q9UPQ0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LIMCH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HeLa shows localization to actin filaments. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules and cells in glomeruli. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
HPA063840-100ul |
|
|
|
|
|
|
|
|
HPA063840-100ul |
|
|
HPA063840-100ul |
Produktgarantie und fachkundiger Support
