Anti-MPP5
Artikelnummer:
ATA-HPA063890
- Bilder (8)
| Artikelname: | Anti-MPP5 |
| Artikelnummer: | ATA-HPA063890 |
| Hersteller Artikelnummer: | HPA063890 |
| Alternativnummer: | ATA-HPA063890-100,ATA-HPA063890-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ12615, PALS1 |
| membrane palmitoylated protein 5 |
| Anti-MPP5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64398 |
| UniProt: | Q8N3R9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | INSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MPP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human colon, eye, retina, kidney and lymph node using Anti-MPP5 antibody HPA063890 (A) shows similar protein distribution across tissues to independent antibody HPA000993 (B). |
|
|
Immunohistochemical staining of human eye, retina using Anti-MPP5 antibody HPA063890. |
|
|
Immunohistochemical staining of human kidney using Anti-MPP5 antibody HPA063890. |
|
|
Immunohistochemical staining of human colon using Anti-MPP5 antibody HPA063890. |
|
|
Immunohistochemical staining of human lymph node using Anti-MPP5 antibody HPA063890. |
|
|
HPA063890-100ul |
|
|
HPA063890-100ul |
|
|
HPA063890-100ul |
Produktgarantie und fachkundiger Support
