Anti-MMP9

Artikelnummer: ATA-HPA063909
Artikelname: Anti-MMP9
Artikelnummer: ATA-HPA063909
Hersteller Artikelnummer: HPA063909
Alternativnummer: ATA-HPA063909-100,ATA-HPA063909-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLG4B
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Anti-MMP9
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4318
UniProt: P14780
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MMP9
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-MMP9 antibody. Corresponding MMP9 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human bone marrow shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and MMP9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401553).
HPA063909-100ul
HPA063909-100ul
HPA063909-100ul