Anti-AQP5
Artikelnummer:
ATA-HPA065008
- Bilder (10)
| Artikelname: | Anti-AQP5 |
| Artikelnummer: | ATA-HPA065008 |
| Hersteller Artikelnummer: | HPA065008 |
| Alternativnummer: | ATA-HPA065008-100,ATA-HPA065008-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AQP5 |
| aquaporin 5 |
| Anti-AQP5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 362 |
| UniProt: | P55064 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | AQP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane. |
|
|
Immunohistochemistry analysis in human salivary gland and liver tissues using HPA065008 antibody. Corresponding AQP5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows strong positivity in apical membrane in exocrine glandular cells. |
|
|
Immunohistochemical staining of human salivary gland shows strong positivity in apical membrane in glandular cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA065008-100ul |
|
|
|
|
|
HPA065008-100ul |
|
|
HPA065008-100ul |
Produktgarantie und fachkundiger Support
