Anti-HSD17B1
Artikelnummer:
ATA-HPA065296
- Bilder (9)
| Artikelname: | Anti-HSD17B1 |
| Artikelnummer: | ATA-HPA065296 |
| Hersteller Artikelnummer: | HPA065296 |
| Alternativnummer: | ATA-HPA065296-100,ATA-HPA065296-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1 |
| hydroxysteroid (17-beta) dehydrogenase 1 |
| Anti-HSD17B1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3292 |
| UniProt: | P14061 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HSD17B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human placenta and prostate tissues using Anti-HSD17B1 antibody. Corresponding HSD17B1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, lymph node, placenta and prostate using Anti-HSD17B1 antibody HPA065296 (A) shows similar protein distribution across tissues to independent antibody HPA021032 (B). |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-HSD17B1 antibody HPA065296. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-HSD17B1 antibody HPA065296. |
|
|
HPA065296-100ul |
|
|
HPA065296-100ul |
|
|
HPA065296-100ul |
Produktgarantie und fachkundiger Support
