Anti-RAD23A
Artikelnummer:
ATA-HPA065599
| Artikelname: |
Anti-RAD23A |
| Artikelnummer: |
ATA-HPA065599 |
| Hersteller Artikelnummer: |
HPA065599 |
| Alternativnummer: |
ATA-HPA065599-100,ATA-HPA065599-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
HHR23A, MGC111083 |
| RAD23 homolog A (S. cerevisiae) |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
5886 |
| UniProt: |
P54725 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
RAD23A |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:200 - 1:500 |
|
Immunohistochemical staining of human salivary gland shows strong nuclear positivity in glandular cells. |
|
HPA065599-100ul |