Anti-ZZZ3
Artikelnummer:
ATA-HPA066197
| Artikelname: |
Anti-ZZZ3 |
| Artikelnummer: |
ATA-HPA066197 |
| Hersteller Artikelnummer: |
HPA066197 |
| Alternativnummer: |
ATA-HPA066197-100,ATA-HPA066197-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ATAC1, DKFZP564I052 |
| zinc finger, ZZ-type containing 3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
26009 |
| UniProt: |
Q8IYH5 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
ZZZ3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:500 - 1:1000 |
![]()
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in glomeruli. |
![]()
|
HPA066197-100ul |
