Anti-BMP4, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-BMP4, Rabbit, Polyclonal
• Artikelnummer: ATA-HPA066235
• Hersteller Artikelnummer: HPA066235
• Alternativnummer: ATA-HPA066235-100,ATA-HPA066235-25
• Hersteller: Atlas Antibodies
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: BMP2B

Produktbeschreibung

bone morphogenetic protein 4

Zusatzinformationen

Anti-BMP4

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.4 mg/ml
• Isotyp: IgG
• NCBI: 652
• UniProt: P12644
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Affinity purified using the PrEST antigen as affinity ligand
• Sequenz: KVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPELP
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Bilder

Immunohistochemistry analysis in human prostate and pancreas tissues using Anti-BMP4 antibody. Corresponding BMP4 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human prostate shows high expression.

Immunohistochemical staining of human pancreas shows low expression as expected.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue