Anti-PLIN3
Artikelnummer:
ATA-HPA066538
- Bilder (8)
| Artikelname: | Anti-PLIN3 |
| Artikelnummer: | ATA-HPA066538 |
| Hersteller Artikelnummer: | HPA066538 |
| Alternativnummer: | ATA-HPA066538-100,ATA-HPA066538-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | M6PRBP1, PP17, TIP47 |
| perilipin 3 |
| Anti-PLIN3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10226 |
| UniProt: | O60664 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLIN3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to lipid droplets. |
|
|
Immunohistochemical staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PLIN3 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
HPA066538-100ul |
|
|
|
|
|
|
|
|
HPA066538-100ul |
|
|
HPA066538-100ul |
Produktgarantie und fachkundiger Support
