Anti-RBM24
Artikelnummer:
ATA-HPA066927
- Bilder (8)
| Artikelname: | Anti-RBM24 |
| Artikelnummer: | ATA-HPA066927 |
| Hersteller Artikelnummer: | HPA066927 |
| Alternativnummer: | ATA-HPA066927-100,ATA-HPA066927-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ259A10.1, FLJ30829, RNPC6 |
| RNA binding motif protein 24 |
| Anti-RBM24 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 221662 |
| UniProt: | Q9BX46 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RBM24 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human heart muscle and skin tissues using Anti-RBM24 antibody. Corresponding RBM24 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
HPA066927-100ul |
|
|
|
|
|
HPA066927-100ul |
|
|
HPA066927-100ul |
Produktgarantie und fachkundiger Support
