Anti-CDK10

Artikelnummer: ATA-HPA067060
Artikelname: Anti-CDK10
Artikelnummer: ATA-HPA067060
Hersteller Artikelnummer: HPA067060
Alternativnummer: ATA-HPA067060-100,ATA-HPA067060-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PISSLRE
cyclin-dependent kinase 10
Anti-CDK10
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 8558
UniProt: Q15131
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDK10
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
HPA067060-100ul