Anti-CYTL1

Artikelnummer: ATA-HPA067201
Artikelname: Anti-CYTL1
Artikelnummer: ATA-HPA067201
Hersteller Artikelnummer: HPA067201
Alternativnummer: ATA-HPA067201-100,ATA-HPA067201-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C17, C4orf4
cytokine like 1
Anti-CYTL1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 54360
UniProt: Q9NRR1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CYTL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nuclear membrane & endoplasmic reticulum.
HPA067201-100ul