Anti-PSMD11
Artikelnummer:
ATA-HPA067433
- Bilder (8)
| Artikelname: | Anti-PSMD11 |
| Artikelnummer: | ATA-HPA067433 |
| Hersteller Artikelnummer: | HPA067433 |
| Alternativnummer: | ATA-HPA067433-100,ATA-HPA067433-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC3844, p44.5, Rpn6, S9 |
| proteasome 26S subunit, non-ATPase 11 |
| Anti-PSMD11 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5717 |
| UniProt: | O00231 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMD11 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & the Golgi apparatus. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear and cytoplasmic positivity in seminiferous ducts and Leydig cells. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA067433-100ul |
|
|
|
|
|
|
|
|
HPA067433-100ul |
|
|
HPA067433-100ul |
Produktgarantie und fachkundiger Support
