Anti-ENDOU
Artikelnummer:
ATA-HPA067448
- Bilder (9)
| Artikelname: | Anti-ENDOU |
| Artikelnummer: | ATA-HPA067448 |
| Hersteller Artikelnummer: | HPA067448 |
| Alternativnummer: | ATA-HPA067448-100,ATA-HPA067448-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P11, PP11, PRSS26 |
| endonuclease, polyU-specific |
| Anti-ENDOU |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8909 |
| UniProt: | P21128 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ENDOU |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-ENDOU antibody. Corresponding ENDOU RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human esophagus, lymph node, skeletal muscle and testis using Anti-ENDOU antibody HPA067448 (A) shows similar protein distribution across tissues to independent antibody HPA012388 (B). |
|
|
Immunohistochemical staining of human esophagus shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human testis using Anti-ENDOU antibody HPA067448. |
|
|
Immunohistochemical staining of human lymph node using Anti-ENDOU antibody HPA067448. |
|
|
HPA067448-100ul |
|
|
HPA067448-100ul |
|
|
HPA067448-100ul |
Produktgarantie und fachkundiger Support
