Anti-SP140

Artikelnummer: ATA-HPA067493
Artikelname: Anti-SP140
Artikelnummer: ATA-HPA067493
Hersteller Artikelnummer: HPA067493
Alternativnummer: ATA-HPA067493-100,ATA-HPA067493-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LYSP100-A, LYSP100-B
SP140 nuclear body protein
Anti-SP140
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 11262
UniProt: Q13342
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SP140
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-SP140 antibody. Corresponding SP140 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
HPA067493-100ul
HPA067493-100ul
HPA067493-100ul