Anti-RUVBL2
Artikelnummer:
ATA-HPA067966
- Bilder (10)
| Artikelname: | Anti-RUVBL2 |
| Artikelnummer: | ATA-HPA067966 |
| Hersteller Artikelnummer: | HPA067966 |
| Alternativnummer: | ATA-HPA067966-100,ATA-HPA067966-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b |
| RuvB-like AAA ATPase 2 |
| Anti-RUVBL2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.7 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10856 |
| UniProt: | Q9Y230 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RUVBL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, cytosol & centrosome. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using Anti-RUVBL2 antibody. Corresponding RUVBL2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis using Anti-RUVBL2 antibody HPA067966 (A) shows similar pattern to independent antibody HPA042880 (B). |
|
|
HPA067966-100ul |
|
|
|
|
|
|
|
|
HPA067966-100ul |
|
|
HPA067966-100ul |
Produktgarantie und fachkundiger Support
