Anti-SLC22A18AS
Artikelnummer:
ATA-HPA068288
- Bilder (10)
| Artikelname: | Anti-SLC22A18AS |
| Artikelnummer: | ATA-HPA068288 |
| Hersteller Artikelnummer: | HPA068288 |
| Alternativnummer: | ATA-HPA068288-100,ATA-HPA068288-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BWR1B, BWSCR1B, ORCTL2S, p27-BWR1B, SLC22A1LS |
| solute carrier family 22 (organic cation transporter), member 18 antisense |
| Anti-SLC22A18AS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5003 |
| UniProt: | Q8N1D0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC22A18AS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human duodenum and liver tissues using Anti-SLC22A18AS antibody. Corresponding SLC22A18AS RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG |
|
|
HPA068288-100ul |
|
|
|
|
|
|
|
|
HPA068288-100ul |
|
|
HPA068288-100ul |
Produktgarantie und fachkundiger Support
