Anti-CUZD1

Artikelnummer: ATA-HPA068479
Artikelname: Anti-CUZD1
Artikelnummer: ATA-HPA068479
Hersteller Artikelnummer: HPA068479
Alternativnummer: ATA-HPA068479-100,ATA-HPA068479-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ERG-1, UO-44
CUB and zona pellucida-like domains 1
Anti-CUZD1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 50624
UniProt: Q86UP6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QVSLRASDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSMSSVYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CUZD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human pancreas and colon tissues using Anti-CUZD1 antibody. Corresponding CUZD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, lymph node, pancreas and testis using Anti-CUZD1 antibody HPA068479 (A) shows similar protein distribution across tissues to independent antibody HPA068660 (B).
Immunohistochemical staining of human pancreas shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-CUZD1 antibody HPA068479.
Immunohistochemical staining of human cerebral cortex using Anti-CUZD1 antibody HPA068479.
Immunohistochemical staining of human testis using Anti-CUZD1 antibody HPA068479.
HPA068479-100ul
HPA068479-100ul
HPA068479-100ul