Anti-SYNPO2

Artikelnummer: ATA-HPA068563
Artikelname: Anti-SYNPO2
Artikelnummer: ATA-HPA068563
Hersteller Artikelnummer: HPA068563
Alternativnummer: ATA-HPA068563-100,ATA-HPA068563-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MYOPODIN
synaptopodin 2
Anti-SYNPO2
Klonalität: Polyclonal
Konzentration: 0.9 mg/ml
Isotyp: IgG
NCBI: 171024
UniProt: Q9UMS6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SYNPO2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol, actin filaments & vesicles.
Immunohistochemistry analysis in human smooth muscle and skin tissues using Anti-SYNPO2 antibody. Corresponding SYNPO2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human smooth muscle shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
HPA068563-100ul
HPA068563-100ul
HPA068563-100ul