Anti-IL10RA

Artikelnummer: ATA-HPA069086
Artikelname: Anti-IL10RA
Artikelnummer: ATA-HPA069086
Hersteller Artikelnummer: HPA069086
Alternativnummer: ATA-HPA069086-100,ATA-HPA069086-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD210, CD210a, CDW210A, HIL-10R, IL10R
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 3587
UniProt: Q13651
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL
Target-Kategorie: IL10RA
Antibody Type: Monoclonal Antibody
HPA069086-100ul