Anti-CCR3

Artikelnummer: ATA-HPA069514
Artikelname: Anti-CCR3
Artikelnummer: ATA-HPA069514
Hersteller Artikelnummer: HPA069514
Alternativnummer: ATA-HPA069514-100,ATA-HPA069514-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CC-CKR-3, CD193, CKR3, CMKBR3
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 1232
UniProt: P51677
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI
Target-Kategorie: CCR3
Antibody Type: Monoclonal Antibody
HPA069514-100ul