Anti-GDF11
Artikelnummer:
ATA-HPA069609
- Bilder (8)
| Artikelname: | Anti-GDF11 |
| Artikelnummer: | ATA-HPA069609 |
| Hersteller Artikelnummer: | HPA069609 |
| Alternativnummer: | ATA-HPA069609-100,ATA-HPA069609-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BMP-11 |
| growth differentiation factor 11 |
| Anti-GDF11 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10220 |
| UniProt: | O95390 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GDF11 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human seminal vesicle and skeletal muscle tissues using Anti-GDF11 antibody. Corresponding GDF11 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human seminal vesicle shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA069609-100ul |
|
|
|
|
|
HPA069609-100ul |
|
|
HPA069609-100ul |
Produktgarantie und fachkundiger Support
