Anti-FOXL2
Artikelnummer:
ATA-HPA069613
- Bilder (10)
| Artikelname: | Anti-FOXL2 |
| Artikelnummer: | ATA-HPA069613 |
| Hersteller Artikelnummer: | HPA069613 |
| Alternativnummer: | ATA-HPA069613-100,ATA-HPA069613-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ChIP, ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BPES, BPES1 |
| forkhead box L2 |
| Anti-FOXL2 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 668 |
| UniProt: | P58012 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FOXL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to nucleus & cytokinetic bridge. |
|
|
Immunohistochemistry analysis in human ovary and skeletal muscle tissues using HPA069613 antibody. Corresponding FOXL2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human endometrium shows weak nuclear positivity in cells in endometrial stroma. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in stromal cells. |
|
|
Immunohistochemical staining of human ovary shows moderate nuclear positivity in stromal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA069613-100ul |
|
|
|
|
|
HPA069613-100ul |
|
|
HPA069613-100ul |
Produktgarantie und fachkundiger Support
