Anti-CD28 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA070003
Artikelname: Anti-CD28 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA070003
Hersteller Artikelnummer: HPA070003
Alternativnummer: ATA-HPA070003-100,ATA-HPA070003-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
CD28 molecule
Anti-CD28
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 940
UniProt: P10747
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD28
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human lymph node and liver tissues using HPA070003 antibody. Corresponding CD28 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows no positivity in neuronal cells as expected.
Immunohistochemical staining of human tonsil shows moderate membranous positivity in lymphocytes.
Immunohistochemical staining of human liver shows no positivity in hepatocytes.
Immunohistochemical staining of human lymph node shows moderate membranous positivity in lymphocytes.
HPA070003
HPA070003
HPA070003