Anti-CORO1B

Artikelnummer: ATA-HPA070456
Artikelname: Anti-CORO1B
Artikelnummer: ATA-HPA070456
Hersteller Artikelnummer: HPA070456
Alternativnummer: ATA-HPA070456-100,ATA-HPA070456-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: coronin-2
coronin, actin binding protein, 1B
Anti-CORO1B
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 57175
UniProt: Q9BR76
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CORO1B
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-CORO1B antibody. Corresponding CORO1B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and U-251MG using Anti-CORO1B antibody. Corresponding CORO1B RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
HPA070456-100ul
HPA070456-100ul
HPA070456-100ul