Anti-RUNDC3A
Artikelnummer:
ATA-HPA070733
- Bilder (8)
| Artikelname: | Anti-RUNDC3A |
| Artikelnummer: | ATA-HPA070733 |
| Hersteller Artikelnummer: | HPA070733 |
| Alternativnummer: | ATA-HPA070733-100,ATA-HPA070733-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RAP2IP, RPIP8 |
| RUN domain containing 3A |
| Anti-RUNDC3A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10900 |
| UniProt: | Q59EK9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RUNDC3A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, hippocampus and liver using Anti-RUNDC3A antibody HPA070733 (A) shows similar protein distribution across tissues to independent antibody HPA023548 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-RUNDC3A antibody HPA070733. |
|
|
Immunohistochemical staining of human liver using Anti-RUNDC3A antibody HPA070733. |
|
|
Immunohistochemical staining of human hippocampus using Anti-RUNDC3A antibody HPA070733. |
|
|
Immunohistochemical staining of human colon using Anti-RUNDC3A antibody HPA070733. |
|
|
HPA070733-100ul |
|
|
HPA070733-100ul |
|
|
HPA070733-100ul |
Produktgarantie und fachkundiger Support
