Anti-ZBTB14, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA070819
| Artikelname: |
Anti-ZBTB14, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA070819 |
| Hersteller Artikelnummer: |
HPA070819 |
| Alternativnummer: |
ATA-HPA070819-100,ATA-HPA070819-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB, ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ZFP161, ZNF478 |
| zinc finger and BTB domain containing 14 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.3 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
7541 |
| UniProt: |
O43829 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
DMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPCVCEMCTKGFTTQAHLKEH |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli. |
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
|
|