Anti-ZBTB14, Rabbit, Polyclonal

Artikelnummer: ATA-HPA070819
Artikelname: Anti-ZBTB14, Rabbit, Polyclonal
Artikelnummer: ATA-HPA070819
Hersteller Artikelnummer: HPA070819
Alternativnummer: ATA-HPA070819-100,ATA-HPA070819-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB, ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ZFP161, ZNF478
zinc finger and BTB domain containing 14
Anti-ZBTB14
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 7541
UniProt: O43829
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPCVCEMCTKGFTTQAHLKEH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.