Anti-SMC2

Artikelnummer: ATA-HPA071309
Artikelname: Anti-SMC2
Artikelnummer: ATA-HPA071309
Hersteller Artikelnummer: HPA071309
Alternativnummer: ATA-HPA071309-100,ATA-HPA071309-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAP-E, hCAP-E, SMC2L1
structural maintenance of chromosomes 2
Anti-SMC2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10592
UniProt: O95347
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SMC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus.
Immunohistochemical staining of human tonsil shows nuclear positivity in germinal center and non germinal center.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA071309-100ul
HPA071309-100ul
HPA071309-100ul