Anti-CCNF
Artikelnummer:
ATA-HPA071600
- Bilder (10)
| Artikelname: | Anti-CCNF |
| Artikelnummer: | ATA-HPA071600 |
| Hersteller Artikelnummer: | HPA071600 |
| Alternativnummer: | ATA-HPA071600-100,ATA-HPA071600-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FBX1, FBXO1 |
| cyclin F |
| Anti-CCNF |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 899 |
| UniProt: | P41002 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCNF |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human tonsil and pancreas tissues using Anti-CCNF antibody. Corresponding CCNF RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver, lymph node, pancreas and skin using Anti-CCNF antibody HPA071600 (A) shows similar protein distribution across tissues to independent antibody HPA070495 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human tonsil shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-CCNF antibody HPA071600. |
|
|
Immunohistochemical staining of human liver using Anti-CCNF antibody HPA071600. |
|
|
Immunohistochemical staining of human skin using Anti-CCNF antibody HPA071600. |
|
|
HPA071600-100ul |
|
|
HPA071600-100ul |
|
|
HPA071600-100ul |
Produktgarantie und fachkundiger Support
