Anti-GOT1
Artikelnummer:
ATA-HPA072629
- Bilder (10)
| Artikelname: | Anti-GOT1 |
| Artikelnummer: | ATA-HPA072629 |
| Hersteller Artikelnummer: | HPA072629 |
| Alternativnummer: | ATA-HPA072629-100,ATA-HPA072629-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AST1 |
| glutamic-oxaloacetic transaminase 1, soluble |
| Anti-GOT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2805 |
| UniProt: | P17174 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GOT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemistry analysis in human heart muscle and lymph node tissues using Anti-GOT1 antibody. Corresponding GOT1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Western blot analysis using Anti-GOT1 antibody HPA072629 (A) shows similar pattern to independent antibody HPA064532 (B). |
|
|
HPA072629-100ul |
|
|
|
|
|
|
|
|
HPA072629-100ul |
|
|
HPA072629-100ul |
Produktgarantie und fachkundiger Support
