Anti-YIPF5
Artikelnummer:
ATA-HPA073622
- Bilder (10)
| Artikelname: | Anti-YIPF5 |
| Artikelnummer: | ATA-HPA073622 |
| Hersteller Artikelnummer: | HPA073622 |
| Alternativnummer: | ATA-HPA073622-100,ATA-HPA073622-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FinGER5, SMAP-5 |
| Yip1 domain family, member 5 |
| Anti-YIPF5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 81555 |
| UniProt: | Q969M3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | YIPF5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line BJ shows localization to endoplasmic reticulum & vesicles. |
|
|
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using Anti-YIPF5 antibody. Corresponding YIPF5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4 and human cell line U-251 MG. |
|
|
HPA073622-100ul |
|
|
|
|
|
|
|
|
HPA073622-100ul |
|
|
HPA073622-100ul |
Produktgarantie und fachkundiger Support
