Anti-PLEKHG3
Artikelnummer:
ATA-HPA073702
- Bilder (8)
| Artikelname: | Anti-PLEKHG3 |
| Artikelnummer: | ATA-HPA073702 |
| Hersteller Artikelnummer: | HPA073702 |
| Alternativnummer: | ATA-HPA073702-100,ATA-HPA073702-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARHGEF43, KIAA0599 |
| pleckstrin homology and RhoGEF domain containing G3 |
| Anti-PLEKHG3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26030 |
| UniProt: | A1L390 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PDGGETLYVTADLTLEDNRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPSQQGR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLEKHG3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-PLEKHG3 antibody HPA073702 (A) shows similar protein distribution across tissues to independent antibody HPA074734 (B). |
|
|
Immunohistochemical staining of human colon using Anti-PLEKHG3 antibody HPA073702. |
|
|
Immunohistochemical staining of human kidney using Anti-PLEKHG3 antibody HPA073702. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PLEKHG3 antibody HPA073702. |
|
|
Immunohistochemical staining of human liver using Anti-PLEKHG3 antibody HPA073702. |
|
|
HPA073702-100ul |
|
|
HPA073702-100ul |
|
|
HPA073702-100ul |
Produktgarantie und fachkundiger Support
