Anti-NUP37
Artikelnummer:
ATA-HPA073708
- Bilder (8)
| Artikelname: | Anti-NUP37 |
| Artikelnummer: | ATA-HPA073708 |
| Hersteller Artikelnummer: | HPA073708 |
| Alternativnummer: | ATA-HPA073708-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ22618, MGC5585 |
| nucleoporin 37kDa |
| Anti-NUP37 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79023 |
| UniProt: | Q8NFH4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NUP37 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-NUP37 antibody. Corresponding NUP37 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Western blot analysis using Anti-NUP37 antibody HPA073708 (A) shows similar pattern to independent antibody HPA056300 (B). |
|
|
HPA073708-100ul |
|
|
|
|
|
HPA073708-100ul |
|
|
HPA073708-100ul |
Produktgarantie und fachkundiger Support
