Anti-FBXL19 ChIP certified
Artikelnummer:
ATA-HPA074250
| Artikelname: |
Anti-FBXL19 ChIP certified |
| Artikelnummer: |
ATA-HPA074250 |
| Hersteller Artikelnummer: |
HPA074250 |
| Alternativnummer: |
ATA-HPA074250-100,ATA-HPA074250-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CXXC11, DKFZp434K0410, Fbl19, JHDM1C |
| Klonalität: |
Polyclonal |
| Isotyp: |
IgG |
| NCBI: |
54620 |
| UniProt: |
Q6PCT2 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
GNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASAEGP |
| Target-Kategorie: |
FBXL19 |
| Antibody Type: |
Monoclonal Antibody |
|
HPA074250-100ul |