Anti-SCG5
Artikelnummer:
ATA-HPA074618
- Bilder (8)
| Artikelname: | Anti-SCG5 |
| Artikelnummer: | ATA-HPA074618 |
| Hersteller Artikelnummer: | HPA074618 |
| Alternativnummer: | ATA-HPA074618-100,ATA-HPA074618-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 7B2, SGNE1, SgV |
| secretogranin V |
| Anti-SCG5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6447 |
| UniProt: | P05408 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SCG5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human lymph node, pancreas, pituitary gland and testis using Anti-SCG5 antibody HPA074618 (A) shows similar protein distribution across tissues to independent antibody HPA013136 (B). |
|
|
Immunohistochemical staining of human lymph node using Anti-SCG5 antibody HPA074618. |
|
|
Immunohistochemical staining of human testis using Anti-SCG5 antibody HPA074618. |
|
|
Immunohistochemical staining of human pituitary gland using Anti-SCG5 antibody HPA074618. |
|
|
Immunohistochemical staining of human pancreas using Anti-SCG5 antibody HPA074618. |
|
|
HPA074618-100ul |
|
|
HPA074618-100ul |
|
|
HPA074618-100ul |
Produktgarantie und fachkundiger Support
