Anti-ZBTB45 ChIP certified
Artikelnummer:
ATA-HPA075485
| Artikelname: |
Anti-ZBTB45 ChIP certified |
| Artikelnummer: |
ATA-HPA075485 |
| Hersteller Artikelnummer: |
HPA075485 |
| Alternativnummer: |
ATA-HPA075485-100,ATA-HPA075485-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FLJ14486, ZNF499 |
| Klonalität: |
Polyclonal |
| Isotyp: |
IgG |
| NCBI: |
84878 |
| UniProt: |
Q96K62 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH |
| Target-Kategorie: |
ZBTB45 |
| Antibody Type: |
Monoclonal Antibody |
|
HPA075485-100ul |