Anti-DNAJC5B

Artikelnummer: ATA-HPA077389
Artikelname: Anti-DNAJC5B
Artikelnummer: ATA-HPA077389
Hersteller Artikelnummer: HPA077389
Alternativnummer: ATA-HPA077389-100,ATA-HPA077389-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CSP-beta, MGC26226
DnaJ heat shock protein family (Hsp40) member C5 beta
Anti-DNAJC5B
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 85479
UniProt: Q9UF47
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC5B
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to vesicles.
HPA077389-100ul