Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb FL490 Conjugate, Clone: [L21/32], Gallus

Produktübersicht

• Artikelname: Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb FL490 Conjugate, Clone: [L21/32], Gallus
• Artikelnummer: AVL-78-002-FL490
• Hersteller Artikelnummer: 78-002-FL490
• Alternativnummer: AVL-78-002-FL490
• Hersteller: Aves Labs
• Wirt: Gallus
• Kategorie: Antikörper
• Applikation: ICC, IHC
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
• Konjugation: FL490
• Alternative Synonym: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Produktbeschreibung

Our chicken Anti-GluA2/GluR2 glutamate receptor FL490 conjugate recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in IHC, ICC.

Produkteigenschaften

• Klonalität: Recombinant
• Konzentration: 0.5 mg/mL
• Klon-Bezeichnung: [L21/32]
• Molekulargewicht: 90 kDa
• UniProt: P19491
• Formulierung: Liquid
• Target-Kategorie: GluA2/GluR2 glutamate receptor
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Dilution Range: IHC: 1:250-1:500. Dilution Range: ICC: 1:500