Recombinant Mouse Carboxylesterase 1C (Ces1c), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC20256
Artikelname: Recombinant Mouse Carboxylesterase 1C (Ces1c), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC20256
Hersteller Artikelnummer: RPC20256
Alternativnummer: BIM-RPC20256-20UG,BIM-RPC20256-100UG,BIM-RPC20256-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Liver carboxylesterase NLung surfactant convertasePES-N
Recombinant Mouse Carboxylesterase 1C (Ces1c), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ces1c. Target Synonyms: Liver carboxylesterase NLung surfactant convertasePES-N. Accession Number: P23953. Expression Region: 19~550aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 60.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 60.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQC
Target-Kategorie: Ces1c