Recombinant Human Hyaluronidase-2 (HYAL2), Unconjugated, Yeast

Artikelnummer: BIM-RPC20266
Artikelname: Recombinant Human Hyaluronidase-2 (HYAL2), Unconjugated, Yeast
Artikelnummer: BIM-RPC20266
Hersteller Artikelnummer: RPC20266
Alternativnummer: BIM-RPC20266-20UG,BIM-RPC20266-100UG,BIM-RPC20266-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Hyaluronoglucosaminidase-2Lung carcinoma protein 2, LuCa-2
Recombinant Human Hyaluronidase-2 (HYAL2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HYAL2. Target Synonyms: Hyaluronoglucosaminidase-2Lung carcinoma protein 2, LuCa-2. Accession Number: Q12891. Expression Region: 21~448aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 51.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 51.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEA
Target-Kategorie: HYAL2