Recombinant Human Delta-like protein 3 (DLL3), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC20271
Artikelname: Recombinant Human Delta-like protein 3 (DLL3), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC20271
Hersteller Artikelnummer: RPC20271
Alternativnummer: BIM-RPC20271-20UG,BIM-RPC20271-100UG,BIM-RPC20271-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Drosophila Delta homolog 3, Delta3
Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DLL3. Target Synonyms: Drosophila Delta homolog 3, Delta3. Accession Number: Q9NYJ7. Expression Region: 27~492aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGN
Target-Kategorie: DLL3