Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla), Unconjugated, E. coli

Artikelnummer: BIM-RPC20275
Artikelname: Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla), Unconjugated, E. coli
Artikelnummer: BIM-RPC20275
Hersteller Artikelnummer: RPC20275
Alternativnummer: BIM-RPC20275-20UG,BIM-RPC20275-100UG,BIM-RPC20275-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Carbapenem-hydrolyzing beta-lactamase KPC-2
Recombinant Klebsiella oxytoca Carbapenem-hydrolyzing beta-lactamase KPC (bla) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Klebsiella oxytoca. Target Name: bla. Target Synonyms: Carbapenem-hydrolyzing beta-lactamase KPC-2. Accession Number: Q848S6. Expression Region: 25~293aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAA
Target-Kategorie: bla