Recombinant Streptomyces alboniger Puromycin N-acetyltransferase (pac), Unconjugated, E. coli

Artikelnummer: BIM-RPC20294
Artikelname: Recombinant Streptomyces alboniger Puromycin N-acetyltransferase (pac), Unconjugated, E. coli
Artikelnummer: BIM-RPC20294
Hersteller Artikelnummer: RPC20294
Alternativnummer: BIM-RPC20294-20UG,BIM-RPC20294-100UG,BIM-RPC20294-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: pac, Puromycin N-acetyltransferase, EC 2.3
Recombinant Streptomyces alboniger Puromycin N-acetyltransferase (pac) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptomyces alboniger. Target Name: pac. Target Synonyms: pac, Puromycin N-acetyltransferase, EC 2.3. Accession Number: P13249. Expression Region: 1~199aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA
Target-Kategorie: pac