Recombinant Phleum pratense Pollen allergen Phl p 5b, Unconjugated, E. coli

Artikelnummer: BIM-RPC20305
Artikelname: Recombinant Phleum pratense Pollen allergen Phl p 5b, Unconjugated, E. coli
Artikelnummer: BIM-RPC20305
Hersteller Artikelnummer: RPC20305
Alternativnummer: BIM-RPC20305-20UG,BIM-RPC20305-100UG,BIM-RPC20305-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Allergen Phl p VbAllergen: Phl p 5b
Recombinant Phleum pratense Pollen allergen Phl p 5b is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Phleum pratense (Common timothy). Target Name: Phleum pratense Pollen allergen Phl p 5b. Target Synonyms: Allergen Phl p VbAllergen: Phl p 5b. Accession Number: Q40963. Expression Region: 20~284aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 42.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGA
Target-Kategorie: Phleum pratense Pollen allergen Phl p 5b