Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Unconjugated, E. coli

Artikelnummer: BIM-RPC20306
Artikelname: Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY), Unconjugated, E. coli
Artikelnummer: BIM-RPC20306
Hersteller Artikelnummer: RPC20306
Alternativnummer: BIM-RPC20306-20UG,BIM-RPC20306-100UG,BIM-RPC20306-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: uvsY, Recombination protein uvsY
Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4). Target Name: uvsY. Target Synonyms: uvsY, Recombination protein uvsY. Accession Number: P04537. Expression Region: 1~137aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
Target-Kategorie: uvsY