Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX), Unconjugated, E. coli

Artikelnummer: BIM-RPC20308
Artikelname: Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX), Unconjugated, E. coli
Artikelnummer: BIM-RPC20308
Hersteller Artikelnummer: RPC20308
Alternativnummer: BIM-RPC20308-20UG,BIM-RPC20308-100UG,BIM-RPC20308-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: UVSX,Recombination and repair protein
Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4). Target Name: UVSX. Target Synonyms: UVSX,Recombination and repair protein. Accession Number: P04529. Expression Region: 1~391aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 60kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 60kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSDLKSRLIKASTSKLTAELTASKFFNEKDVVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKKETEDALNEKVVSDMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTYETQEMFSKTVMGGGTGPMYSADTVFIIGKRQIKDGSDLQGYQFVLNVEKSRTVKEKSK
Target-Kategorie: UVSX