Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC20325
Artikelname: Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC20325
Hersteller Artikelnummer: RPC20325
Alternativnummer: BIM-RPC20325-20UG,BIM-RPC20325-100UG,BIM-RPC20325-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: T-lymphocyte differentiation antigen T8/Leu-2CD_antigen: CD8a
Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CD8A. Target Synonyms: T-lymphocyte differentiation antigen T8/Leu-2CD_antigen: CD8a. Accession Number: P01732. Expression Region: 22~182aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Target-Kategorie: CD8A